Protein Info for BT2742 in Bacteroides thetaiotaomicron VPI-5482

Annotation: integrase, site-specific recombinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF13495: Phage_int_SAM_4" amino acids 2 to 85 (84 residues), 31.7 bits, see alignment E=2.5e-11 PF02899: Phage_int_SAM_1" amino acids 3 to 87 (85 residues), 71.2 bits, see alignment E=1.1e-23 TIGR02224: tyrosine recombinase XerC" amino acids 5 to 293 (289 residues), 342.1 bits, see alignment E=1.4e-106 PF00589: Phage_integrase" amino acids 109 to 280 (172 residues), 131.6 bits, see alignment E=3.9e-42

Best Hits

Swiss-Prot: 37% identical to XERC_NATTJ: Tyrosine recombinase XerC (xerC) from Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)

KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 100% identity to bth:BT_2742)

Predicted SEED Role

"Integrase, site-specific recombinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A461 at UniProt or InterPro

Protein Sequence (293 amino acids)

>BT2742 integrase, site-specific recombinase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MLIKSFLDYLRYERNYSEKTVLAYGEDIKQLQEFAQEEYGKFDPLEVEGELIREWIVSLM
DRGYTSTSVNRKLSSLRSFYKYLLRQGEVTVDPLRKITGPKNKKPLPAFLKESEMDKLLD
DTDFGEGFKGCRDRLIIGVFYATGIRLSELIGLDDKDVDFSASLLKVTGKRNKQRLIPFG
DELKELMLEYINVRNETIPERSEAFFVKEDGERLYKNLVYNLVKRNLSKVATLKKRSPHV
LRHTFATTMLNNDAELGAVKELLGHESVATTEIYTHATFEELKKVYKQAHPRA