Protein Info for BT2706 in Bacteroides thetaiotaomicron VPI-5482

Annotation: methionine aminopeptidase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00500: methionine aminopeptidase, type I
  • amino acids 2 to 251 (250 residues), 294 bits, E=4.6e-92
• PF00557: Peptidase_M24
  • amino acids 11 to 242 (232 residues), 164.6 bits, E=1.4e-52

Best Hits

Swiss-Prot: 52% identical to MAP1_CLOAB: Methionine aminopeptidase (map) from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 100% identity to bth:BT_2706)

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

• Arg/N-end rule pathway (eukaryotic) (6/14 steps found)
• Ac/N-end rule pathway (6/21 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.18

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

See Q8A497 at UniProt or InterPro

Protein Sequence (265 amino acids)

>BT2706 methionine aminopeptidase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MIFLKTEDEIELLRQSNLLVGRTLAEVAKVVKPGVTTRELDKVAEEFIRDNGATPTFKGF
PNQYGDPFPASICTSVNEQVVHGIPGDIVLKDGDIVSVDCGTYMNGFCGDSAYTFCVGEV
DEEIRTLLKVTKEALYIGIQNAVHGKRIGDIGYAIQQYCESHSYGVVREFVGHGIGKEMH
EDPQVPNYGKRGYGPLMKRGLCIAIEPMITLGDRQVIMEGDGWTVRTRDRKCAAHFEHTV
AVGAGEADILSSFKFIEEVLGDKAI