Protein Info for BT2697 in Bacteroides thetaiotaomicron VPI-5482

Annotation: DNA mismatch repair protein mutS (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 57 to 74 (18 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 444 to 459 (16 residues), see Phobius details PF05192: MutS_III" amino acids 129 to 377 (249 residues), 43 bits, see alignment E=7e-15 PF00488: MutS_V" amino acids 427 to 587 (161 residues), 92.8 bits, see alignment E=2.7e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2697)

Predicted SEED Role

"MutS-related protein, family 1" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A4A6 at UniProt or InterPro

Protein Sequence (604 amino acids)

>BT2697 DNA mismatch repair protein mutS (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MEKQENIIATYQQIIQETEQQLQKARKRIRYISLLRLILFVEAVASAIIFWSDGWLKLIV
FTVIPIIAFIWLVQSHNRWFYWKDYLKKKIEINQQELRALQYDFSDFDNGKEYIDPSHLY
TFDLDIFGEHSLFQYINRTSTPIGKQRLANWFNAHLEEKEAIEQRQEAIRELSSELEFRQ
QFRLLGLLYKGKPSDTSEIKEWVNSPSDYRKHAFLRILPTAVGIINLLCIGATILGFLPA
SISGIVFACFVVFSFIFSKGITKIQATYGEKLQILSTYADQILITEKKEMHSPALQQLKA
ELTSQNQTASQSVHRLAKLMNALDQRGNLLMSTILNGLLFWELRQVMQIEKWKEAHSADL
PRWIEAIGAIDAYCSLATFSYNHPDYIYPQITSQSFHLQAEALGHPLMNRNKCVRNGIDM
EKRPFFIIITGANMAGKSTYLRTVGVNYLLACIGAPVWAAKMEIFPARLVTSLRTSDSLT
DNESYFFAELKRLKLIIDKLKAGEELFIILDEILKGTNSMDKQKGSFALIKQFMSMDANG
IIATHDLLLGTLIDAFPQNIRNYCFEADITNNELTFSYQMRSGVAQNMNACFLMKKMGIA
VIDG