Protein Info for BT2603 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved protein found in conjugate transposon (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 799 transmembrane" amino acids 643 to 660 (18 residues), see Phobius details TIGR03783: Bacteroides conjugation system ATPase, TraG family" amino acids 1 to 796 (796 residues), 1580 bits, see alignment E=0 PF12991: DUF3875" amino acids 3 to 55 (53 residues), 95.5 bits, see alignment 2.8e-31 PF19044: P-loop_TraG" amino acids 411 to 796 (386 residues), 655.8 bits, see alignment E=4.4e-201

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2603)

Predicted SEED Role

"Conjugative transposon protein TraG" in subsystem Conjugative transposon, Bacteroidales

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A4J6 at UniProt or InterPro

Protein Sequence (799 amino acids)

>BT2603 conserved protein found in conjugate transposon (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MRNVLKAETLERKFPLLSVENGCIVSKDADLTVAFEVELPELFTMTAAEYEAVHSSWVKA
VKVLPDFSVVCKQDWFTKETYRPDFRDGEQSFLSKSYERHFNERPYLNHKCYLYLTKTTR
ERSRQRSDFNSLCCGSLLPKEMVDKDTAVRFLEAVEQFERIMNDSGHVSLRRLEADEITG
TEGRPGLVEKYFSLSLEDETAVLQDICLNPGGMRVGDKRLCVHTLSDTEDLPVRVSTDMR
YGRMSTDRSDCRLSFAAPVGLLLPCNHIYSQYVFIDDAQEILRTMEKTSRNMLSLSKYSR
SNAVNREWTEMYLDEAHTKGVLPVRCHCNVMAWAEDREELRRVKNDTGSQLAMMECTPRH
NTVDAPVLYWAGIPGNAGDFPAEESFYTFLEQAVCLFTAETNYRSSSSPFGIRMADRRNG
IPLHVDISDLPMKRGIITNRNKFVLGPSGSGKSFFTNHLVRQYYEQGTHILLVDTGNSYQ
GLCRMIHDRTHGEDGIYITYEEDNPIAFNPFYTDSGQFDVEKRESIKTLILTLWKREDEA
PKRSEEVALSGAVNAYIRRITDDRASRPDFNGFYEFVRDDYRRMIEQKKVREKDFDIDGF
LNVLEPFYRGGDYDFLLNSDKELDLTNKRFIVFELDNISSNKVLLPVVTLIIMETFISKM
RKLRGIRKMILIEECWKALMSANMSEYIKYLFKTVRKYFGEAVVVTQEVDDIISSDIVKE
AIINNSDCKILLDQRKYMNKFEHIQKLLGLTEKERGQILSINRANRPGPFYREVWIGLGG
THSAVYATEVSAEEYAVRP