Protein Info for BT2539 in Bacteroides thetaiotaomicron VPI-5482

Annotation: rubredoxin (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00301: Rubredoxin
  • amino acids 3 to 49 (47 residues), 88.7 bits, E=2e-29

Best Hits

Swiss-Prot: 76% identical to RUBR_CLOAB: Rubredoxin (rd) from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

KEGG orthology group: None (inferred from 100% identity to bth:BT_2539)

MetaCyc: 54% identical to MTBE monooxygenase rubredoxin component (Methylibium petroleiphilum PM1)
1.14.13.M36 [EC: 1.14.13.M36]

Predicted SEED Role

"Rubredoxin" in subsystem Rubrerythrin

MetaCyc Pathways

• methyl tert-butyl ether degradation (1/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.M36

Sequence Analysis Tools

See Q8A4Q8 at UniProt or InterPro

Protein Sequence (54 amino acids)

>BT2539 rubredoxin (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKKYICTVCEYIYDPAQGDPESGIEPGTAFEDIPDDWTCPLCGVGKEDFEPYEG