Protein Info for BT2518 in Bacteroides thetaiotaomicron VPI-5482

Annotation: phosphoribosylaminoimidazole carboxylase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01162: phosphoribosylaminoimidazole carboxylase, catalytic subunit
  • amino acids 7 to 161 (155 residues), 201.8 bits, E=2.1e-64
• PF00731: AIRC
  • amino acids 7 to 152 (146 residues), 206.9 bits, E=5.5e-66

Best Hits

Swiss-Prot: 55% identical to PURE_PYRAB: N5-carboxyaminoimidazole ribonucleotide mutase (purE) from Pyrococcus abyssi (strain GE5 / Orsay)

KEGG orthology group: K01588, 5-(carboxyamino)imidazole ribonucleotide mutase [EC: 5.4.99.18] (inferred from 100% identity to bth:BT_2518)

MetaCyc: 48% identical to N5-carboxyaminoimidazole ribonucleotide mutase (Escherichia coli K-12 substr. MG1655)
5-(carboxyamino)imidazole ribonucleotide mutase. [EC: 5.4.99.18]

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• inosine-5'-phosphate biosynthesis I (5/6 steps found)
• inosine-5'-phosphate biosynthesis III (4/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.21 or 5.4.99.18

Sequence Analysis Tools

See Q8A4S9 at UniProt or InterPro

Protein Sequence (171 amino acids)

>BT2518 phosphoribosylaminoimidazole carboxylase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKMTPIVSIIMGSTSDLPVMEKAAQLLNDMHVPFEMNALSAHRTPEAVEEFAKNARSRGI
KVIIAAAGMAAALPGVIAANTTLPVIGVPVKGSVLDGVDALYSIIQMPPGIPVATVAING
AMNAAILAIQMLALSDAALAEAFAAYKEGLKKKIVKANEELKEVKFEYKTN