Protein Info for BT2499 in Bacteroides thetaiotaomicron VPI-5482

Annotation: peptide methionine sulfoxide reductase msrA/msrB (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 28 to 177 (150 residues), 204.1 bits, see alignment E=1.5e-64 PF01625: PMSR" amino acids 28 to 178 (151 residues), 214.1 bits, see alignment E=1.1e-67 TIGR00357: methionine-R-sulfoxide reductase" amino acids 201 to 334 (134 residues), 211.3 bits, see alignment E=4.5e-67 PF01641: SelR" amino acids 206 to 325 (120 residues), 173.2 bits, see alignment E=2e-55

Best Hits

Swiss-Prot: 56% identical to MSRAB_HAEIN: Peptide methionine sulfoxide reductase MsrA/MsrB (msrAB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K12267, peptide methionine sulfoxide reductase msrA/msrB [EC: 1.8.4.11 1.8.4.12] (inferred from 100% identity to bth:BT_2499)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) / Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.11, EC 1.8.4.12)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.11 or 1.8.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A4U8 at UniProt or InterPro

Protein Sequence (342 amino acids)

>BT2499 peptide methionine sulfoxide reductase msrA/msrB (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKHIIIAVILTISNVFLGIAKPMKSQAEIYFAGGCFWGTEHFLKQIRGVESTQVGYANST
VANPSYEQVCSGKTNAAETVKVVYDPEEVNLSLLLNLYFQTIDPTSLNRQGNDRGTQYRT
GIYYINKADLSTINQAIQALATQYNKPIAVEVEPLTNFYPAEVYHQDYLDKNPGGYCHIN
LALFEMARKANAPKPPTFQKPDDATLRKKLSAEQYAVTQKNATEPAFHNEFWNEHRPGIY
VDITTGEPLFVSTDKFDSGCGWPSFSKPIQKELIAEKKDTTHGMIRTEVRSKTGDAHLGH
VFTDGPKDKGGLRYCINSASLRFIPKEKMKEEGYGEYLPLIK