Protein Info for BT2479 in Bacteroides thetaiotaomicron VPI-5482

Annotation: iron-regulated protein A precursor (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF09375: Peptidase_M75" amino acids 30 to 214 (185 residues), 108.1 bits, see alignment E=3.1e-35 amino acids 247 to 368 (122 residues), 95.1 bits, see alignment E=2.8e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2479)

Predicted SEED Role

"FIG00405865: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A4W8 at UniProt or InterPro

Protein Sequence (372 amino acids)

>BT2479 iron-regulated protein A precursor (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKKFFYLSALSLGMMCSITACSDDDTTTIDAKNLDYTAENASSWGNYMRVVAQLLVNDAT
ALYDDWAVKYNEGGSYADFFKNQDALTSVEQLIDGCVDIANEVGTAKIGDPYDLFIHNNE
EKALYAVESWYSWHSREDYRNNIYSIRNAYYGTRTGAISELSLSKAVAAVNANLDTEVKK
AIDDAAAAIWAIPSPFRNNINSPEAVSAMEACATLEGVLKGSLKSCIEGIDKTVLAEVVK
NYVDVVVLPTYSDLKAGNQALFDAVETFRTSPSNANFKACATAWLAARTPWETSEAFLFG
PVADKGLDPNMDSWPLDQDGIVQILTSGNYSDLNWDGDYDEEDDKIAGAQALRGYHTLEY
LIFKDGEARTIQ