Protein Info for BT2425 in Bacteroides thetaiotaomicron VPI-5482

Annotation: K+-transporting ATPase A chain (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 169 to 193 (25 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 374 to 400 (27 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details amino acids 490 to 517 (28 residues), see Phobius details amino acids 537 to 558 (22 residues), see Phobius details TIGR00680: K+-transporting ATPase, A subunit" amino acids 5 to 567 (563 residues), 607.4 bits, see alignment E=1.3e-186 PF03814: KdpA" amino acids 11 to 566 (556 residues), 755.1 bits, see alignment E=1.8e-231

Best Hits

Swiss-Prot: 100% identical to KDPA_BACTN: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 100% identity to bth:BT_2425)

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A519 at UniProt or InterPro

Protein Sequence (568 amino acids)

>BT2425 K+-transporting ATPase A chain (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNTEILGVVAQVALMVILAYPLGRYIAKVYKGEKTWSDFMAPIERVIYKVCGIDPKEEMN
WKQFLKALLILNAFWFVWGMVLLVSQGWLPLNPDGNGPQTPDQAFNTCISFMVNCNLQHY
SGESGLTYFTQLFVIMLFQFITAATGMAAMAGIMKSMAAKTTKTIGNFWHFLVVSCTRIL
LPLSLIVGFILILQGTPMGFDGKMKVTTLEGQEQMVSQGPAAAIVPIKQLGTNGGGYFGV
NSSHPLENPTYLTNMVECWSILIIPMAMVLALGFYTRRKKLAYSIFGVMLFAFLVGVCIN
VSQEMGGNPRIDELGIAQDNGAMEGKEVRLGAGATALWSIVTTVTSNGSVNGMHDSTMPL
SGMMEMLNMQINTWFGGVGVGWMNYYTFIIIAVFISGLMVGRTPEFLGKKVEAREMKIAT
IVALLHPFVILVFTAISSYIYVYHPDFVESEGGWLNNLGFHGLSEQLYEYTSCAANNGSG
FEGLGDNTYFWNWTCGIVLILSRFLPIIGQVAIAGLLAQKKFIPESAGTLKTDTLTFGIM
TFVVIFIVAALSFFPVHALSTIAEHLSL