Protein Info for BT2406 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative DNA repair protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 TIGR00416: DNA repair protein RadA" amino acids 1 to 449 (449 residues), 593.4 bits, see alignment E=1.4e-182 PF18073: Rubredoxin_2" amino acids 8 to 34 (27 residues), 45.3 bits, see alignment (E = 2.2e-15) PF13481: AAA_25" amino acids 75 to 219 (145 residues), 46.9 bits, see alignment E=1e-15 PF06745: ATPase" amino acids 78 to 137 (60 residues), 27.4 bits, see alignment E=8.6e-10 PF13541: ChlI" amino acids 341 to 427 (87 residues), 43.3 bits, see alignment E=1.3e-14 PF05362: Lon_C" amino acids 350 to 452 (103 residues), 35.9 bits, see alignment E=2.5e-12

Best Hits

Swiss-Prot: 51% identical to RADA_BACSU: DNA repair protein RadA (radA) from Bacillus subtilis (strain 168)

KEGG orthology group: K04485, DNA repair protein RadA/Sms (inferred from 100% identity to bth:BT_2406)

Predicted SEED Role

"DNA repair protein RadA" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A538 at UniProt or InterPro

Protein Sequence (455 amino acids)

>BT2406 putative DNA repair protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MAKEKTVYVCSNCGQESPKWVGKCPSCGEWNTYVEEIVRKETTNRRPVSGIETQKAKPVI
LSEIEADDEPRINMHDDELNRVLGGGLVPGSLVLIGGEPGIGKSTLVMQTVLRMPDKKIL
YVSGEESARQLKLRADRLSEVSSDCLIVCETSLEQIYVHIKNTSPDLVIIDSIQTISTEN
IESSPGSIAQVRECSASILRFAKETHTPVLLIGHINKEGSIAGPKVLEHIVDTVLQFEGD
QHYMYRILRSIKNRFGSTAELGIYEMRQDGLRQVSNPSELLLSQDHEGMSGVAIASAIEG
VRPFLIETQALVSSAVYGNPQRSATGFDIRRMNMLLAVLEKRVGFKLAQKDVFLNIAGGL
KVNDPAIDLAVISAILSSNMDAAVEPEVCMAGEIGLSGEIRPVNRIEQRIGEAEKLGFKR
FLLPKYNLQGIDTQKLKIELVPVRKVEEAFRALFG