Protein Info for BT2382 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative cardiolipin synthetase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details TIGR04265: cardiolipin synthase" amino acids 8 to 473 (466 residues), 413.9 bits, see alignment E=5.2e-128 PF13396: PLDc_N" amino acids 19 to 58 (40 residues), 34.7 bits, see alignment 2e-12 PF13091: PLDc_2" amino acids 131 to 236 (106 residues), 45.5 bits, see alignment E=1e-15 amino acids 316 to 439 (124 residues), 107.4 bits, see alignment E=7.4e-35 PF00614: PLDc" amino acids 213 to 238 (26 residues), 27.3 bits, see alignment (E = 3.9e-10) amino acids 388 to 413 (26 residues), 31.7 bits, see alignment (E = 1.6e-11)

Best Hits

KEGG orthology group: K06131, cardiolipin synthase [EC: 2.7.8.-] (inferred from 100% identity to bth:BT_2382)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A560 at UniProt or InterPro

Protein Sequence (474 amino acids)

>BT2382 putative cardiolipin synthetase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MRWIWYCTLLAYIAFLLGLIYTIIIDYDDKNPVKTICWILVVIFLPLLGISAYYIVGRNV
SKKRSKFQFWREEFNRHQQSVSTNVETEPIHPDHYKELKSLILNLEQSPVFGGNKVTVYP
GGKSKFYSLFEDIDCAESHIHIFYYAIGDDHIGNELKEKIINKVKQGIKVRLLYDGLGCN
KTNRKYFKQMIEAGVEVKTFLPLSFPRFLRSVNYRNHKKIVIIDGRIAYTGGINVKDVYI
DGLLWGKWNDIHFKVEGSGASGLQSVFLADWYYASGQYLSSPEYYPNVEVFGEVPIQVVN
AEPLGMHSNVMEAMFTAITRAKKNVYIETPYFIPTECLLQAIQTASMSGIDVRLVMPKRS
DNDFVQYASNSYVEKLLRNKVRVYQYVNGFTHSKLMIVDDELVVVGSANMDIRSLELLFE
TNLFIYDKKVAQTVRDIYHTDMNNSKELNLRDWLQRNRSVKFREACFRLFSPVY