Protein Info for BT2276 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative permease (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 34 to 52 (19 residues), see Phobius details amino acids 64 to 87 (24 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 220 to 248 (29 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details amino acids 280 to 297 (18 residues), see Phobius details amino acids 317 to 347 (31 residues), see Phobius details PF01594: AI-2E_transport" amino acids 19 to 349 (331 residues), 163.3 bits, see alignment E=4.3e-52

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2276)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A5G3 at UniProt or InterPro

Protein Sequence (377 amino acids)

>BT2276 putative permease (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MERKKITFDSFIRGSIGCVLVVGILMLVERLSGVLLPFFIAWLIAYMVYPLVKFFQYKLR
LKSRIVSIFCSLFLITLVGVSLFYLLVPPMISEIGRMNDLLVTYLTNGAGNNVPKNLSEF
IHENIDLQALNRILSEENILAAIKDTVPRVWALLAESLNILFSILASFIILLYVIFILLD
YEVIAEGWLHLLPNKYRTFASNLVHDVQDGMNRYFRGQALVAFCVGILFSIGFLIIDFPM
AIALGLFIGALNMVPYLQIIGFLPTVLLAILKAADTGENFWIIIACALAVFAIVQIIQDT
FLVPKIMGKITGLNPAIILLSLSIWGSLMGMLGMIIALPLTTLMLSYYQRFIINKERIKY
DEVETTDNQETSDKEEK