Protein Info for BT2273 in Bacteroides thetaiotaomicron VPI-5482

Annotation: methyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF00590: TP_methylase" amino acids 3 to 202 (200 residues), 125 bits, see alignment E=2.1e-40 TIGR00096: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase" amino acids 4 to 220 (217 residues), 249.3 bits, see alignment E=2.5e-78

Best Hits

Swiss-Prot: 50% identical to RSMI_THEMA: Ribosomal RNA small subunit methyltransferase I (rsmI) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K07056, (no description) (inferred from 100% identity to bth:BT_2273)

Predicted SEED Role

"rRNA small subunit methyltransferase I" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A5G6 at UniProt or InterPro

Protein Sequence (224 amino acids)

>BT2273 methyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MGKLYVVPTPVGNLEDMTFRAIRVLKEVDLILAEDTRTSGILLKHFEIKNAMQSHHKFNE
HKTVESVVNRIKAGETVALISDAGTPGISDPGFLVVRECVRNGIEVQCLPGATAFVPALV
ASGLPNEKFCFEGFLPQKKGRQTRLKALAEEHRTMVFYESPHRLLKTLTQFAEYFGTERQ
ATVSREISKLHEETVRGSLAELIEHFTATEPRGEIVIVLAGIDD