Protein Info for BT2271 in Bacteroides thetaiotaomicron VPI-5482

Annotation: haloacid dehalogenase-like hydrolase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 TIGR02254: noncanonical pyrimidine nucleotidase, YjjG family" amino acids 3 to 229 (227 residues), 212.6 bits, see alignment E=7.9e-67 PF00702: Hydrolase" amino acids 3 to 198 (196 residues), 83.3 bits, see alignment E=4.7e-27 PF13419: HAD_2" amino acids 7 to 201 (195 residues), 68.3 bits, see alignment E=1.4e-22 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 106 to 197 (92 residues), 40 bits, see alignment E=7.8e-14 PF13242: Hydrolase_like" amino acids 160 to 226 (67 residues), 40.4 bits, see alignment E=3.4e-14

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to bth:BT_2271)

Predicted SEED Role

"Putative FMN hydrolase (EC 3.1.3.-); 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase" (EC 3.1.3.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A5G8 at UniProt or InterPro

Protein Sequence (230 amino acids)

>BT2271 haloacid dehalogenase-like hydrolase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKYKNLFFDLDDTIWAFSRNARDTFEEVYQKYSFDRYFDSFDHYYTLYQRRNTELWLEYG
EGKVTKEELNRQRFFYPLQAVGVEDEALAERFSEDFFAIIPTKSGLMPHAKEVLEYLAPQ
YNLYILSNGFRELQSRKMRSAGVDRYFKKIILSEDLGVLKPRPEIFHFALSATQSELRES
LMIGDSWEADITGAHGVGMHQAFYNVTERTVFPFQPTYHIHSLKELMNLL