Protein Info for BT2258 in Bacteroides thetaiotaomicron VPI-5482

Annotation: GTP-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 TIGR03156: GTP-binding protein HflX" amino acids 14 to 395 (382 residues), 409 bits, see alignment E=7.2e-127 PF13167: GTP-bdg_N" amino acids 31 to 123 (93 residues), 109 bits, see alignment E=2.2e-35 PF16360: GTP-bdg_M" amino acids 125 to 213 (89 residues), 98.9 bits, see alignment E=3e-32 PF01926: MMR_HSR1" amino acids 218 to 336 (119 residues), 77.8 bits, see alignment E=1e-25

Best Hits

Swiss-Prot: 40% identical to HFLX_BACSU: GTPase HflX (hflX) from Bacillus subtilis (strain 168)

KEGG orthology group: K03665, GTP-binding protein HflX (inferred from 100% identity to bth:BT_2258)

Predicted SEED Role

"GTP-binding protein HflX" in subsystem Hfl operon or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A5I1 at UniProt or InterPro

Protein Sequence (419 amino acids)

>BT2258 GTP-binding protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKEFIISEAKVETAVLVGLITQMQDERKTNEYLDELAFLAETAGAEVVKRFTQKLPTANS
VTYVGKGKLEEIRQYIRTEEEEEREVGMVIFDDELSAKQIRNIEAELKVKILDRTSLILD
IFAMRAQTANAKTQVELAQYKYMLPRLQRLWTHLERQGGGSGSGSGKGGSVGLRGPGETQ
LEMDRRIILNRMSLLKERLAEIDKQKATQRKNRGRMIRVALVGYTNVGKSTIMNLLAKSE
VFAENKLFATLDTTVRKVIIDNLPFLLSDTVGFIRKLPTDLVDSFKSTLDEVREADLLVH
VVDISHPGFEEQIEVVNKTLADIGGGGKPMILIFNKIDAYTYVEKAPDDLTPRTKENLTL
EELMKTWMAKMEDNCLFISARERINIDELKDVVYQRVKELHVQKYPYNDFLYQTYEEEE