Protein Info for BT2249 in Bacteroides thetaiotaomicron VPI-5482

Annotation: ribosome recycling factor (ribosome releasing factor) (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 TIGR00496: ribosome recycling factor" amino acids 12 to 186 (175 residues), 201 bits, see alignment E=5.8e-64 PF01765: RRF" amino acids 22 to 184 (163 residues), 215.7 bits, see alignment E=1.8e-68

Best Hits

Swiss-Prot: 100% identical to RRF_BACTN: Ribosome-recycling factor (frr) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02838, ribosome recycling factor (inferred from 100% identity to bth:BT_2249)

Predicted SEED Role

"Ribosome recycling factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A5J0 at UniProt or InterPro

Protein Sequence (186 amino acids)

>BT2249 ribosome recycling factor (ribosome releasing factor) (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MVDVKTCLDNAQEKMDMAVMYLEEALAHIRAGKASTRLLDGIRVDSYGSMVPISNVAALS
TPDARSITIKPWDKSMFRAIEKAIIDSDLGIMPENNGEVIRIGIPPLTEERRRQLAKQCK
AEGETAKVSVRNARRDGIDALKKAVKDGLAEDEQKNAEAKLQKIHDKYIKQIEDMLADKD
KEIMTV