Protein Info for BT2248 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative integral membrane protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 193 to 216 (24 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details PF00892: EamA" amino acids 12 to 120 (109 residues), 50.2 bits, see alignment E=1.7e-17 amino acids 131 to 266 (136 residues), 64.6 bits, see alignment E=6e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2248)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A5J1 at UniProt or InterPro

Protein Sequence (284 amino acids)

>BT2248 putative integral membrane protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNPLFTLPLYAAGMSVDTVLFYRYAFAVIVLGVLMKLQGQSFTLRKADILPLVIMGLLFS
FSSLLLFMSYNYMDAGIASTILFVYPVMVAVIMGAFFKEKISAITVFSILLALSGIALLY
QGDGNKPLSTVGIIFVLLSSLSYAIYIVGVNRSSLKTLPTTKLTFYAILFGLSVYIVRLN
FCTELQIIPSPLLWADVLALAILPTAVSLICTALAIQSIGSTPTAILGALEPVTALFFGV
LLFHEKLTPRLMVGILMIITAVTLIIIGKSLIKKMSVLLQISKK