Protein Info for BT2167 in Bacteroides thetaiotaomicron VPI-5482

Annotation: elongation factor G (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 718 PF00009: GTP_EFTU" amino acids 8 to 277 (270 residues), 120.3 bits, see alignment E=2.4e-38 TIGR00231: small GTP-binding protein domain" amino acids 9 to 177 (169 residues), 58.7 bits, see alignment E=3e-20 PF03144: GTP_EFTU_D2" amino acids 315 to 381 (67 residues), 42.2 bits, see alignment E=2.7e-14 PF14492: EFG_III" amino acids 396 to 468 (73 residues), 56.6 bits, see alignment E=6.7e-19 PF03764: EFG_IV" amino acids 470 to 511 (42 residues), 32.4 bits, see alignment 2.1e-11 amino acids 521 to 617 (97 residues), 71.2 bits, see alignment E=2e-23 PF00679: EFG_C" amino acids 621 to 706 (86 residues), 85.3 bits, see alignment E=7.2e-28

Best Hits

KEGG orthology group: K02355, elongation factor G (inferred from 100% identity to bth:BT_2167)

Predicted SEED Role

"Translation elongation factor G-related protein" in subsystem Translation elongation factor G family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A5S1 at UniProt or InterPro

Protein Sequence (718 amino acids)

>BT2167 elongation factor G (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKVYQTNEIKNIALLGSSGSGKTTLVEAMLFESGVIKRRGSVAAKNTVSDYFPVEQEYGY
SVFSTVLHVEWNNKKLNIIDCPGSDDFVGSTVTALNVTDTAIILLNGQYGVEVGTQNHFR
YTEKLNKPVIFLVNQLDNEKCDYDNILEQLKEAYGSKVVPIQYPIATGPGFNALIDVLLM
KKYSWKPEGGAPVIEDIPAEEMDKAMEMHKALVEAAAENDEGLMEKFFEQDSLTEDEMRE
GIRKGLIARGMFPVFCVCGGKDMGVRRLMEFLGNVVPFVSEMPKVENTDGKEVAPDVNGP
ESLYFFKTSVEPHIGEVSYFKVMSGKVREGDDLLNADRGSKERIAQIYVVAGGNRVKVEE
LQAGDIGAAVKLKDVKTGNTLNGKDCDYKFNFIKYPNSKYSRAIKPVNEADVEKMMTILN
RMREEDPTWVIEQSKELKQTLVHGQGEFHLRTLKWRLENNEKLQVKFEEPKIPYRETITK
AARADYRHKKQSGGAGQFGEVHLIVEPYKEGMPVPDTYKFNGQEFKITVRGTEEIPLEWG
GKLVFINSIVGGSIDARFLPAIMKGIMSRLEQGPLTGSYARDVRVIVYDGKMHPVDSNEI
SFMLAGRNAFSEAFKNAGPKILEPIYDVEVFVPSDRMGDVMGDLQGRRAMIMGMSSEKGF
EKLVAKVPLKEMSSYSTALSSLTGGRASFIMKFASYELVPTDVQDKLIKDFEAKQTEE