Protein Info for BT2162 in Bacteroides thetaiotaomicron VPI-5482

Annotation: 30S ribosomal protein S18 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 90 TIGR00165: ribosomal protein bS18" amino acids 20 to 87 (68 residues), 111.7 bits, see alignment E=7.7e-37 PF01084: Ribosomal_S18" amino acids 32 to 82 (51 residues), 91.2 bits, see alignment E=1.8e-30

Best Hits

Swiss-Prot: 100% identical to RS18_BACTN: 30S ribosomal protein S18 (rpsR) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02963, small subunit ribosomal protein S18 (inferred from 97% identity to bfs:BF3631)

Predicted SEED Role

"SSU ribosomal protein S18p @ SSU ribosomal protein S18p, zinc-independent"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A5S6 at UniProt or InterPro

Protein Sequence (90 amino acids)

>BT2162 30S ribosomal protein S18 (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MAQQTQSEIRYLTPPSVDVKKKKYCRFKKSGIRYIDYKDPEFLKKFLNEQGKILPRRITG
TSLKFQRRIAQAVKRARHLALLPYVTDMMK