Protein Info for BT2140 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative sodium-dependent transporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 15 to 44 (30 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2140)

Predicted SEED Role

"putative sodium-dependent transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A5U8 at UniProt or InterPro

Protein Sequence (297 amino acids)

>BT2140 putative sodium-dependent transporter (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MLKFLKNWTLPIAMLVGAVGYPIFIYFSFLTPYLIFTMLLLTFCKVSPHDLKPKPLHAWL
LLIQIGGAFLAYLLLYRFNKIVAEGVMVCIICPTATAAAVITSKLGGSAASLTTYTLLGN
IGAAIAVPILFPLIEVNPDVSFWGAFWVILSKVFPLLICPFLAAWLLSKFLPKVHQKLLG
YHELAFYLWAVSLAIVTAQTLYSLLNDPADGFTEIMIAVGALIACCLQFFLGKTIGSVYN
DRISGGQALGQKNTILAIWMAHTYLNPLSSVAPGSYVLWQNIINSWQLWKKRKKEIK