Protein Info for BT2076 in Bacteroides thetaiotaomicron VPI-5482

Updated annotation (from data): acetohydroxybutanoate synthase regulatory subunit (EC 2.2.1.6)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR00119.
Original annotation: acetohydroxyacid synthase small subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01842: ACT
  • amino acids 7 to 71 (65 residues), 42.3 bits, E=7.6e-15
• TIGR00119: acetolactate synthase, small subunit
  • amino acids 9 to 161 (153 residues), 89.4 bits, E=1.2e-29
• PF22629: ACT_AHAS_ss
  • amino acids 11 to 76 (66 residues), 46.9 bits, E=3.9e-16
• PF10369: ALS_ss_C
  • amino acids 89 to 161 (73 residues), 57.6 bits, E=1.6e-19

Best Hits

KEGG orthology group: K01653, acetolactate synthase I/III small subunit [EC: 2.2.1.6] (inferred from 100% identity to bth:BT_2076)

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (16/17 steps found)
• superpathway of L-isoleucine biosynthesis I (11/13 steps found)
• L-valine biosynthesis (4/4 steps found)
• L-isoleucine biosynthesis I (from threonine) (6/7 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• L-isoleucine biosynthesis II (6/8 steps found)
• superpathway of L-threonine metabolism (13/18 steps found)
• pyruvate fermentation to (R)-acetoin I (2/3 steps found)
• pyruvate fermentation to (S)-acetoin (2/3 steps found)
• pyruvate fermentation to (R)-acetoin II (1/2 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• L-isoleucine biosynthesis IV (3/6 steps found)
• superpathway of (R,R)-butanediol biosynthesis (2/5 steps found)
• superpathway of 2,3-butanediol biosynthesis (2/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

See Q8A610 at UniProt or InterPro

Protein Sequence (187 amino acids)

>BT2076 acetohydroxybutanoate synthase regulatory subunit  (EC 2.2.1.6) (Bacteroides thetaiotaomicron VPI-5482)
MSDKTLYTIIVHSENIAGLLNQVTAVFTRRQINIESLNVSASSIKGVHKYTITAWTDKDT
IEKVVKQIEKKIDVIQAHYFTEDEIYFHEIALYKVSTPAFQETPEASKVIRRYNARIVEV
NPVFSIVEKNGMSEEITSLYEELRALKCVLQFVRSGRVAITTSCFERVNEFLDGQEAKYK
QSKKEQE