Protein Info for BT2072 in Bacteroides thetaiotaomicron VPI-5482

Annotation: aconitate hydratase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01340: aconitate hydratase, mitochondrial
  • amino acids 14 to 746 (733 residues), 1094.4 bits, E=0
• PF00330: Aconitase
  • amino acids 34 to 477 (444 residues), 483.5 bits, E=7.7e-149
• PF00694: Aconitase_C
  • amino acids 554 to 683 (130 residues), 131.4 bits, E=2.6e-42

Best Hits

Swiss-Prot: 60% identical to ACON_DICDI: Probable aconitate hydratase, mitochondrial (aco2) from Dictyostelium discoideum

KEGG orthology group: K01681, aconitate hydratase 1 [EC: 4.2.1.3] (inferred from 100% identity to bth:BT_2072)

MetaCyc: 60% identical to aconitase (Aspergillus terreus)
Aconitate hydratase. [EC: 4.2.1.3]

Predicted SEED Role

"Aconitate hydratase (EC 4.2.1.3)" in subsystem Propionate-CoA to Succinate Module or Serine-glyoxylate cycle or TCA Cycle (EC 4.2.1.3)

MetaCyc Pathways

• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• reductive TCA cycle I (9/11 steps found)
• mixed acid fermentation (12/16 steps found)
• TCA cycle I (prokaryotic) (7/10 steps found)
• TCA cycle III (animals) (7/10 steps found)
• glyoxylate cycle (4/6 steps found)
• TCA cycle II (plants and fungi) (6/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• TCA cycle VII (acetate-producers) (6/9 steps found)
• reductive TCA cycle II (8/12 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (18/26 steps found)
• nitrogen remobilization from senescing leaves (5/8 steps found)
• partial TCA cycle (obligate autotrophs) (5/8 steps found)
• superpathway of glyoxylate bypass and TCA (7/12 steps found)
• methylaspartate cycle (11/19 steps found)
• ethene biosynthesis V (engineered) (15/25 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (6/14 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.3

Sequence Analysis Tools

See Q8A614 at UniProt or InterPro

Protein Sequence (747 amino acids)

>BT2072 aconitate hydratase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MVYDLTMLEAFYSAYKGKVEHVRAVLKRPLTLAEKILYAHLFNEGDLKNYKRGEDYVNFR
PDRVAMQDATAQMALLQFMNAGKEKVAVPSTVHCDHLIQAYKGAKEDIATATKTNEEVYD
FLRDVSSRYGIGFWKPGAGIIHQVVLENYAFPGGMMVGTDSHTPNAGGLGMVAIGVGGAD
AVDVMTGMEWELKMPRIIGVRLTGKLSGWTSPKDVILKLAGILTVKGGTNSIIEYFGPGT
ASLSATGKATICNMGAEVGATTSLFPFDGRMATYLRATGRDRIVELAEAVDCELRADQQV
TDEPEKYYDRVIDIDLSTLEPYINGPFTPDAATPISEFAEKVLLNGYPRKMEVGLIGSCT
NSSYQDLSRAASLARQVKEKNLSVASPLIINPGSEQIRATAERDGMMDDFMQIGAVIMAN
ACGPCIGQWKRHTDDPTRKNSIVTSFNRNFAKRADGNPNTYAFVASPELTMALTIAGDLC
FNPLKDRLMNHDGEKVKLAEPVGDELPLRGFTSGNEGYITPGGTKTAINVNPASQRLQLL
TPFPAWDGQDILNMPLLIKAQGKCTTDHISMAGPWLRFRGHLENISDNMLMGAVNAFNGE
TNNVWNRSTNTYGTVSGTAKMYKSEGIPSIVVAEENYGEGSSREHAAMEPRFLNVRVILA
KSFARIHETNLKKQGMLALTFADKADYDKIQEHDLLSVIGLPDFAPGRNLTVVLHHEDGT
KESFEAQHTYNEQQIAWFRAGSALNAR