Protein Info for BT2071 in Bacteroides thetaiotaomicron VPI-5482

Annotation: isocitrate dehydrogenase [NADP] (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00183: isocitrate dehydrogenase, NADP-dependent
  • amino acids 2 to 394 (393 residues), 585.1 bits, E=3.8e-180
• PF00180: Iso_dh
  • amino acids 20 to 390 (371 residues), 304.8 bits, E=4.6e-95

Best Hits

Swiss-Prot: 62% identical to IDH_STRSL: Isocitrate dehydrogenase [NADP] (icd) from Streptococcus salivarius

KEGG orthology group: K00031, isocitrate dehydrogenase [EC: 1.1.1.42] (inferred from 100% identity to bth:BT_2071)

MetaCyc: 46% identical to oxalosuccinate reductase subunit (Hydrogenobacter thermophilus)
1.1.1.-

Predicted SEED Role

"Isocitrate dehydrogenase [NADP] (EC 1.1.1.42)" in subsystem TCA Cycle (EC 1.1.1.42)

MetaCyc Pathways

• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• reductive TCA cycle I (9/11 steps found)
• mixed acid fermentation (12/16 steps found)
• TCA cycle I (prokaryotic) (7/10 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• TCA cycle VII (acetate-producers) (6/9 steps found)
• cytosolic NADPH production (yeast) (3/5 steps found)
• reductive TCA cycle II (8/12 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (18/26 steps found)
• nitrogen remobilization from senescing leaves (5/8 steps found)
• partial TCA cycle (obligate autotrophs) (5/8 steps found)
• superpathway of glyoxylate bypass and TCA (7/12 steps found)
• methylaspartate cycle (11/19 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (3/8 steps found)
• ethene biosynthesis V (engineered) (15/25 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glutathione metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.42

Sequence Analysis Tools

See Q8A615 at UniProt or InterPro

Protein Sequence (396 amino acids)

>BT2071 isocitrate dehydrogenase [NADP] (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNKITMQKDGTLSVPDVPVVPYITGDGVGAEVTPSMQSVVNAAVQKAYGGKRRIEWKEVL
AGERAFNETGSWLPDETMKAFQEYLIGIKGPLTTPVGGGIRSLNVALRQTLDLYVCLRPV
RWYQGVHSPVKAPEKVNMCVFRENTEDIYAGIEWEAGTPEAEKFYQFLKNEMGVTKVRFP
ETSSFGVKPVSREGTERLVRAACQYALDHHLPSVTLVHKGNIMKFTEGGFKKWGYELAQR
EFGDALADGRLVIKDCIADAFLQNTLLIPEEYSVIATLNLNGDYVSDQLAAMVGGIGIAP
GANINYKTGHAIFEATHGTAPNIAGKDVVNPCSIILSAVMMLEYLGWKEAAALIEKALEQ
SFLDARATHDLARFMPGGTSLSTTAFTREIVERIEK