Protein Info for BT1999 in Bacteroides thetaiotaomicron VPI-5482

Annotation: anaerobic ribonucleoside-triphosphate reductase activating protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 TIGR02491: anaerobic ribonucleoside-triphosphate reductase activating protein" amino acids 14 to 160 (147 residues), 191.6 bits, see alignment E=3.9e-61 PF13353: Fer4_12" amino acids 22 to 158 (137 residues), 156.3 bits, see alignment E=6e-50 PF04055: Radical_SAM" amino acids 33 to 136 (104 residues), 46.4 bits, see alignment E=5e-16

Best Hits

Swiss-Prot: 42% identical to NRDG_PASMU: Anaerobic ribonucleoside-triphosphate reductase-activating protein (nrdG) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K04068, anaerobic ribonucleoside-triphosphate reductase activating protein [EC: 1.97.1.4] (inferred from 100% identity to bth:BT_1999)

Predicted SEED Role

"Ribonucleotide reductase of class III (anaerobic), activating protein (EC 1.97.1.4)" in subsystem Ribonucleotide reduction (EC 1.97.1.4)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A687 at UniProt or InterPro

Protein Sequence (164 amino acids)

>BT1999 anaerobic ribonucleoside-triphosphate reductase activating protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNTLNSPLSVLHLLSTYPETIVDGEGIRYSIYLAGCSHHCVGCHNPESWNPRAGELLTEE
RIQSIIREIKANPLLDGVTFSGGDPFYNPEAFLLFVKRVKEETGLNIWCYTGYTYEEILA
NPRLKTVLDYIDVLVDGRFEQALFSPYLEFRGSSNQRILRIGNK