Protein Info for BT1979 in Bacteroides thetaiotaomicron VPI-5482

Annotation: Meso-diaminopimelate D-dehydrogenase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 TIGR01921: diaminopimelate dehydrogenase" amino acids 1 to 299 (299 residues), 486.2 bits, see alignment E=2.3e-150 PF01408: GFO_IDH_MocA" amino acids 5 to 88 (84 residues), 31.5 bits, see alignment E=6.3e-11 PF01118: Semialdhyde_dh" amino acids 6 to 89 (84 residues), 26.2 bits, see alignment E=2.4e-09 PF03447: NAD_binding_3" amino acids 10 to 88 (79 residues), 25.2 bits, see alignment E=5.9e-09 PF16654: DAPDH_C" amino acids 120 to 252 (133 residues), 64.7 bits, see alignment E=2.3e-21

Best Hits

Swiss-Prot: 95% identical to DAPDH_BACFN: Meso-diaminopimelate D-dehydrogenase (ddh) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K03340, diaminopimelate dehydrogenase [EC: 1.4.1.16] (inferred from 100% identity to bth:BT_1979)

Predicted SEED Role

"Meso-diaminopimelate D-dehydrogenase (EC 1.4.1.16)" in subsystem Lysine Biosynthesis DAP Pathway (EC 1.4.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A6A6 at UniProt or InterPro

Protein Sequence (299 amino acids)

>BT1979 Meso-diaminopimelate D-dehydrogenase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKKVRAAIVGYGNIGHYVLEALQAAPDFEIAGVVRRAGAENKPEELANYAVVKDIKELEG
VEVAILCTPTRSVEKYAKEYLAMGINTVDSFDIHTGIVDLRRTLDATAKEHKAVSIISAG
WDPGSDSIVRTMLEAIAPKGITYTNFGPGMSMGHTVAVKAIDGVKAALSMTIPTGTGIHR
RMVYIELKDGYKFEEVAAAIKADPYFVNDETHVKLVPSVDALLDMGHGVNLTRKGVSGKT
QNQLFEFNMRINNPALTAQVLVCVARASMKQQPGCYTMVEVPVIDLLPGDREEWIGHLV