Protein Info for BT1967 in Bacteroides thetaiotaomicron VPI-5482

Annotation: multidrug efflux protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 38 to 368 (331 residues), 253.1 bits, see alignment E=1.7e-79 PF16576: HlyD_D23" amino acids 62 to 284 (223 residues), 53.6 bits, see alignment E=3.9e-18 PF13533: Biotin_lipoyl_2" amino acids 64 to 108 (45 residues), 45.1 bits, see alignment 1.3e-15 PF02321: OEP" amino acids 100 to 170 (71 residues), 25.9 bits, see alignment E=1.6e-09 PF13437: HlyD_3" amino acids 171 to 284 (114 residues), 25 bits, see alignment E=5.3e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1967)

Predicted SEED Role

"Multidrug resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A6B7 at UniProt or InterPro

Protein Sequence (380 amino acids)

>BT1967 multidrug efflux protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MSKKVCKMKQGLLLLGCLVAAAGCKQAPPTQMETGYEVMTVSPTDRMISSAYSATIRGRQ
DIDIYPQVGGTLTKVSVTEGQRVKSGQTLFIIDQVPYEAALQTAVANVESAKASLATAQL
TYDSKEELYKENVVSAFDLSTAKNSLLAAKAQLAQAKAQEVSARNNLSYTVVKSPADGVV
GTLPYRVGALVSSSIPEPLTTVSDNSDMYVYFSMTENQLLGLIRQYGSKDEALKSMPAID
LQLNDKSAYPEQGQIESISGVIDRSTGTVSLRAVFPNKDGLLHSGGAGNVVIPVQKTGAL
VIPQGATFEIQDKRYVYKVVDGKAQSSQVQVTRVNGGREFIVDEGLSPGDVIVAEGVGLL
REGTPIKAKTAQASTTTTEN