Protein Info for BT1913 in Bacteroides thetaiotaomicron VPI-5482

Annotation: nicotinate phosphoribosyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 TIGR01514: nicotinate phosphoribosyltransferase" amino acids 2 to 384 (383 residues), 425 bits, see alignment E=1.5e-131 PF17767: NAPRTase_N" amino acids 7 to 127 (121 residues), 110.9 bits, see alignment E=5.3e-36 PF04095: NAPRTase" amino acids 160 to 363 (204 residues), 177.6 bits, see alignment E=3.4e-56

Best Hits

KEGG orthology group: K00763, nicotinate phosphoribosyltransferase [EC: 2.4.2.11] (inferred from 100% identity to bth:BT_1913)

Predicted SEED Role

"Nicotinate phosphoribosyltransferase (EC 2.4.2.11)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 2.4.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A6H1 at UniProt or InterPro

Protein Sequence (389 amino acids)

>BT1913 nicotinate phosphoribosyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MIVRTLLDTDLYKFTTSYAYIKLFPYAMGTFSFNDRNETEYTEEFLEALKSEFNKLSRLR
LTEEELEYMTRNCRFLPRVYWEWLSSFRFDPDKIDIHLDTTGRLHIEVSDFLYKVTLYEV
PLLAIVSEIKNKFFGNVPDMSEILCKLSEKVELSNQHQLRFSEFGTRRRFSIDVQETVIK
RLNDTAKYCTGTSNCYFAMKYGMKMMGTHPHEWFMFHGAQFGYKHANYMALENWVNVYDG
DLGIALSDTYTSGIFLSNLSRKQAKLFDGVRCDSGNEFDFIDKLVARYKELGIDATTKTI
VFSNALDFTKALEIQEYCKDKIRCSFGIGTNLTNDTGFAPSNIVMKLTQCKMNVNQEWRE
CIKLSDDEGKHTGSPEEVQACLYELRLAK