Protein Info for BT1900 in Bacteroides thetaiotaomicron VPI-5482

Annotation: BexA, putative cation effux pump (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 376 to 394 (19 residues), see Phobius details amino acids 405 to 425 (21 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 14 to 402 (389 residues), 184.3 bits, see alignment E=1.8e-58 PF01554: MatE" amino acids 14 to 174 (161 residues), 97 bits, see alignment E=1e-31 amino acids 247 to 393 (147 residues), 51.4 bits, see alignment E=1e-17 PF14667: Polysacc_synt_C" amino acids 128 to 228 (101 residues), 29.8 bits, see alignment E=6.2e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1900)

Predicted SEED Role

"BexA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A6I4 at UniProt or InterPro

Protein Sequence (440 amino acids)

>BT1900 BexA, putative cation effux pump (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKYTYKQIWLINFPVMMSILMEQLINITDAVFLGHVGEIELGASALAGIYYLAIYMLGFG
FSIGLQVMIARRNGEQHYKETGRTFFQGLYFLMVMAIMLCLLIHLVSPFILQQLITSDEI
YQAVIRYLNWRSFGLLFSFPFLAFRAFLVGVTNTKLLSGAALTAVCINIPFNYLLIFKLD
MGISGAAMASSIAEFGAFLILLLYMCKTVDKKKYGLSAVYDGRLLMKLLQLSVWSMLHAF
ISVAPWFLFFVAIEHLGKTELAISNITRSVSTLFFVIVNSFASTTGSLVSNLIGGGQGKE
LFPVCRKVLRLGYVVGLPLILTALWGNQWIIGFYTNNDYLVKLAFWPFIVMLLNYVFALP
GYVYINAVTGTGKTRLAFVFQLVTILIYLIYLYLLSECFHASLTVYMTAEYLFVILLGIQ
SILYLKRKSKQNMYFCTFND