Protein Info for BT1848 in Bacteroides thetaiotaomicron VPI-5482

Annotation: ATP-dependent DNA helicase recQ (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 620 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 20 to 618 (599 residues), 726.6 bits, see alignment E=2.1e-222 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 23 to 469 (447 residues), 566.6 bits, see alignment E=4.4e-174 PF04851: ResIII" amino acids 33 to 190 (158 residues), 28.4 bits, see alignment E=4.5e-10 PF00270: DEAD" amino acids 34 to 192 (159 residues), 89.8 bits, see alignment E=5.1e-29 PF00271: Helicase_C" amino acids 231 to 340 (110 residues), 82.9 bits, see alignment E=6e-27 PF16124: RecQ_Zn_bind" amino acids 353 to 410 (58 residues), 61.7 bits, see alignment 2.8e-20 PF09382: RQC" amino acids 412 to 522 (111 residues), 83.1 bits, see alignment E=4.1e-27 PF00570: HRDC" amino acids 550 to 616 (67 residues), 62.5 bits, see alignment E=9.1e-21

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 100% identity to bth:BT_1848)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A6M9 at UniProt or InterPro

Protein Sequence (620 amino acids)

>BT1848 ATP-dependent DNA helicase recQ (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MIKIAKEKRTFATKFKQMLMKETLKSYFGYDSFRPLQEEIIRHLLNKQDSLVLMPTGGGK
SICYQLPALLSEGTAVVVSPLISLMKDQVETLQANGIAAGALNSSNDETENANLRRACIE
GRLKLLYISPEKLIAEKDYLLRDMSISLFAIDEAHCISQWGHDFRPEYTQMGMLHQQFPQ
VPIIALTATADKITREDIIRQLHLIQPRTFISSFDRPNISLDVKRGFQAKEKNKAILEFI
HRHREESGIIYCMSRNKTETVAQMLQKQGIRCGVYHAGLSPQHRDETQNDFINDRIQVVC
ATIAFGMGIDKSNVRWVIHYNLPKSIESFYQEIGRAGRDGLPSDTVLFYSLGDLILLTKF
ATESNQQTINLEKLQRMQQYAEADICRRRILLSYFGETSTEDCGNCDVCKNPPQRFDGTV
IVQKALSAIARAEQQISTGILIDILRGSYSAEVTAKGYQELKTFGAGRDIPPRDWQDYLL
QMLQLGYFEIAYNENNHLKITPSGSNILFGKAKAMLAVIHREEIVTGKGKKKKVVIAKEL
PFGIPGGENEDLFEALRGLRKQIADQDGLPAYIILSDKVLHLLSISRPTTIEAFGEISGI
GEFKKKKYGKEFVNLIKQFV