Protein Info for BT1840 in Bacteroides thetaiotaomicron VPI-5482

Annotation: histidyl-tRNA synthetase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 TIGR00442: histidine--tRNA ligase" amino acids 7 to 444 (438 residues), 406.5 bits, see alignment E=6.2e-126 PF13393: tRNA-synt_His" amino acids 10 to 69 (60 residues), 25.5 bits, see alignment E=7.6e-10 amino acids 98 to 345 (248 residues), 93 bits, see alignment E=2.1e-30 PF03129: HGTP_anticodon" amino acids 381 to 453 (73 residues), 55.8 bits, see alignment E=4.4e-19

Best Hits

Swiss-Prot: 100% identical to SYH_BACTN: Histidine--tRNA ligase (hisS) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01892, histidyl-tRNA synthetase [EC: 6.1.1.21] (inferred from 100% identity to bth:BT_1840)

Predicted SEED Role

"Histidyl-tRNA synthetase (EC 6.1.1.21)" (EC 6.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A6N7 at UniProt or InterPro

Protein Sequence (454 amino acids)

>BT1840 histidyl-tRNA synthetase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MAAKPSIPKGTRDFSPVEMAKRNYIFNTIRDVYHLYGFQQIETPSMEMLSTLMGKYGDEG
DKLLFKIQNSGDYFSGITDEELLSRNAVKLASKFCEKGLRYDLTVPFARYVVMHRDEITF
PFKRYQIQPVWRADRPQKGRYREFYQCDADVVGSDSLLNEVELMQIVDTVFSRFNIRVCI
KINNRKILSGIAEIIGEADKIVDITVAIDKLDKIGLENVNAELKEKGISDEAIAKLQPII
LLSGTNTEKLATLKSVLAASETGMKGVEESEFILGTLETMGLKNEIELDLTLARGLNYYT
GAIFEVKALDVQIGSITGGGRYDNLTGVFGMAGVSGVGISFGADRIFDVLNQLELYPKEA
VNGTELMFVNFGDKEAAFSMSMLAKVRAAGIRAEIFPDAAKMKKQMSYANAKSVPFVAIV
GENEMNEGKAMLKNMETGEQNLVSVEELIAALRN