Protein Info for BT1833 in Bacteroides thetaiotaomicron VPI-5482

Annotation: two-component system sensor histidine kinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 882 PF00293: NUDIX" amino acids 52 to 163 (112 residues), 38.7 bits, see alignment E=2.9e-13 PF01590: GAF" amino acids 232 to 372 (141 residues), 31.8 bits, see alignment E=5.7e-11 PF13185: GAF_2" amino acids 235 to 373 (139 residues), 28.6 bits, see alignment E=4.6e-10 TIGR00229: PAS domain S-box protein" amino acids 390 to 514 (125 residues), 24.1 bits, see alignment E=1.6e-09 PF08447: PAS_3" amino acids 553 to 639 (87 residues), 28.5 bits, see alignment E=4.5e-10 PF00512: HisKA" amino acids 666 to 730 (65 residues), 72.9 bits, see alignment 5.4e-24 PF02518: HATPase_c" amino acids 776 to 881 (106 residues), 100.5 bits, see alignment E=2.3e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1833)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A6P4 at UniProt or InterPro

Protein Sequence (882 amino acids)

>BT1833 two-component system sensor histidine kinase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MEEKEKAWKTVSSKYLFRRPWLTVRCEDMLLPNGNHIPEYYILEYPDWVNTIAITKDGKF
VFVRQYRPGLGRTSYELCAGVCDKEDASPLVSAQRELWEETGYGKGNWQEYMVISANPST
HTNLTHCFLATDVEPIDHQHLEDTEDLSVHLLTFEEVKQLLENNEIMQSLNAAPLWKYVA
EHAADFEQESVEKVEHEKTETISHRINDLLYYQNSISRSLSRFLKDEEVETGIYEILKDI
LAFYRAGRAYIFETDEENHFYNCTYEVVAEGVKAEINKLQEIPVDFMPWWTSQILGKKPI
LFETLKPMPGMGQGEYEVLSRQGIKALMATPLVVNDHVYGFMGVDLVDGSASWSDEDYRW
LSSLANVISICLELRRAKEKVIFEQAALARSERLFKNIFANIPAGVEIYDKEGNLVDLNE
RDMDILGISDKSEVIGLNFFENPNVDAQILESIRKSSITDFRARYSFECARHTGYYRPLK
AGVIELYTKVRKLYDNHGNLTGYILINMDNTERIDALKPISDFENLFLLISDYAKVGYAK
LNLLNRQGYAIKQWFKNMGEDENTPLSDVVGVYSKMHPDDRSRMLAFFEEAKKGKAKAFK
GEMRILRPGTKNEWNWVRTNVVLNLYEPEKGQVELIGVNYDITALKETEAKLIEAKEKAE
ESDRLKSAFLANMSHEIRTPLNAIVGFSSLMVDTEDMEERRQYMDIVEENNDLLLQLISD
ILDLSKIEAGTFDFTEREVDVNLLCEDIVLAMRMKARPNVEILFDRHLPECRIMSDRNRL
HQVISNFVNNALKFTEEGNIRVGYDQLDEAHLRFYIADTGIGIEPEMQNEIFERFVKLNS
FVHGTGLGLSICRSIVEQLGGEIGVDSEPEKGSCFWFTLPIK