Protein Info for BT1758 in Bacteroides thetaiotaomicron VPI-5482

Updated annotation (from data): fructose transporter
Rationale: Specifically important for utilizing fructose. Also important for utilizing fructooligosaccharides. Part of a PUL for utilizing levan (PMC3225772).
Original annotation: glucose/galactose transporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 76 to 93 (18 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 304 to 331 (28 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 350 (333 residues), 102.7 bits, see alignment E=1e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1758)

Predicted SEED Role

"Predicted glucose transporter in maltodextrin utilization gene cluster" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A6W8 at UniProt or InterPro

Protein Sequence (389 amino acids)

>BT1758 fructose transporter (Bacteroides thetaiotaomicron VPI-5482)
MENTKNASLSKLVPVMLCFFAMGFVDLVGIASNYVKADLGLTDSQANIFPSLVFFWFLIF
SVPTGMLMSRIGQKKTVLLSLIVTFASLLLPVFGDSYALMLISFSLLGIGNALMQTSLNP
LLSNIVRGDRLASSLTFGQFVKAIASFLAPYIAMWGATQAIPSFDLGWRVLFPIYMVIAI
LAILLLNATQIEEEKEEGKPSTFGQCLALLGKPFILLCFIGIMCHVGIDVGTNTTAPKIL
MERIGMTLDDAAFATSLYFIFRTAGCFLGSFILRQMSPKSFFGISVVMMLAAMVGLFIFH
DKAVIYACIALIGFGNSNVFSVIFSQALLYLPGKKNEVSGLMIMGLFGGTVFPLAMGVAS
DTSMGQNGAIAVMTVGVLYLLFYTFRIKK