Protein Info for BT1751 in Bacteroides thetaiotaomicron VPI-5482

Annotation: Glycine betaine transport ATP-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 TIGR01186: glycine betaine/L-proline transport ATP binding subunit" amino acids 35 to 391 (357 residues), 431.9 bits, see alignment E=1e-133 PF00005: ABC_tran" amino acids 43 to 191 (149 residues), 128.6 bits, see alignment E=5.3e-41 PF00571: CBS" amino acids 277 to 329 (53 residues), 22.9 bits, see alignment 1.7e-08 amino acids 338 to 388 (51 residues), 19.9 bits, see alignment 1.5e-07

Best Hits

Swiss-Prot: 53% identical to GBUA_LISM4: Glycine betaine/carnitine transport ATP-binding protein GbuA (gbuA) from Listeria monocytogenes serotype 1/2a (strain 10403S)

KEGG orthology group: K05847, osmoprotectant transport system ATP-binding protein (inferred from 100% identity to bth:BT_1751)

Predicted SEED Role

"Glycine betaine ABC transport system, ATP-binding protein OpuAA (EC 3.6.3.32)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 3.6.3.32)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A6X4 at UniProt or InterPro

Protein Sequence (408 amino acids)

>BT1751 Glycine betaine transport ATP-binding protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MSKIEIKDLYLVFGNEKQKALKMLKEGKTKSEILKATGCTVAVKDANLSINEGEIFVIMG
LSGSGKSTLLRCINRLIRPTSGEVIINGTDIAKVSDKELLQIRRKELAMVFQNFGLLPHR
SVLHNIAFGLELQGVKKGEREQKAMESMQLVGLKGYENQMVSELSGGMQQRVGLARALAN
NPEVLLMDEAFSALDPLIRVQMQDELLTLQSKMKKTIVFITHDLSEAIKLGDRIAIMKDG
EIVQIGTSEEILTEPANAYVERFVENVDRSKIITASSVMVDKPIVARLKKEGPEVLIRKM
RERNLTVLPVVDSNNLLVGEVRLNDLLKLRKEQIRSIESVVRHEVHSVLGDTVLEDILPL
MTKTNSPIWVVNENREFEGVVPLSSLIIEVTGKDKEEINEIIQNAIEL