Protein Info for BT1750 in Bacteroides thetaiotaomicron VPI-5482

Annotation: glycine betaine/L-proline transport system permease (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 39 to 59 (21 residues), see Phobius details amino acids 66 to 82 (17 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 132 to 158 (27 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 103 to 263 (161 residues), 96.3 bits, see alignment E=9.5e-32

Best Hits

Swiss-Prot: 51% identical to OPUAB_BACSU: Glycine betaine transport system permease protein OpuAB (opuAB) from Bacillus subtilis (strain 168)

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 100% identity to bth:BT_1750)

Predicted SEED Role

"Glycine betaine ABC transport system, permease protein OpuAB" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A6X5 at UniProt or InterPro

Protein Sequence (276 amino acids)

>BT1750 glycine betaine/L-proline transport system permease (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MINIGQYIETAINWLTEHFASFFDALSMGIGGFIDGFQHVLFGIPFYITIAVLAALAWFK
SGKGTAVFTLLGLLLIYGMGFWEETMQTLALVLSSTCLALLLGVPLGIWTANSDRCNKIM
RPVLDFMQTMPAFVYLIPAVLFFGLGTVPGAFATIIFAMPPVVRLTGLGIRQVPKNVVEA
SRSFGATPWQLLYKVQLPLALPTILTGINQTIMMSLSMVVIAAMISAGGLGEIVLKGITQ
MKIGLGFEGGIAVVILAIVLDRITQGMADNRKSKKK