Protein Info for BT1749 in Bacteroides thetaiotaomicron VPI-5482

Annotation: glycine betaine-binding protein precursor (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF04069: OpuAC" amino acids 20 to 264 (245 residues), 253.4 bits, see alignment E=1.4e-79

Best Hits

KEGG orthology group: K02002, glycine betaine/proline transport system substrate-binding protein (inferred from 100% identity to bth:BT_1749)

Predicted SEED Role

"Glycine betaine ABC transport system, glycine betaine-binding protein OpuAC" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A6X6 at UniProt or InterPro

Protein Sequence (277 amino acids)

>BT1749 glycine betaine-binding protein precursor (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MFIAGILLTFVSCGDNGKSKKISIAYANWSEGIAMTNLAKAIFEDQGYDVKLLNADLAPI
FTSISRKKADVFMDVWMPVTMEDYMKQYGDKLEVIGDIYDGARIGLVVPDYVTINSIEEL
NAEKERFSGQIVGIDAGAGIMKATDQAIKDYGLDYKLMTSSGPAMTASLKKAIDKKDWIV
VTGWTPHWMFDRFKLKVLQDPKLIYGNTESIHTIAWKGFSEKDPFAAELLGNIRLTDAEI
SSLMTALEEAQTTERQAARQWMEEHQELVNSWIPEKD