Protein Info for BT1693 in Bacteroides thetaiotaomicron VPI-5482

Annotation: periplasmic linker protein, putative multidrug resistance protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 31 to 346 (316 residues), 217.4 bits, see alignment E=1.2e-68 PF16576: HlyD_D23" amino acids 55 to 225 (171 residues), 33.9 bits, see alignment E=3e-12 PF13533: Biotin_lipoyl_2" amino acids 56 to 99 (44 residues), 34.5 bits, see alignment 2e-12 PF13437: HlyD_3" amino acids 152 to 246 (95 residues), 38.8 bits, see alignment E=2e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1693)

Predicted SEED Role

"RND efflux system membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A732 at UniProt or InterPro

Protein Sequence (350 amino acids)

>BT1693 periplasmic linker protein, putative multidrug resistance protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKNIYVIALAAILFQGCGQKKEMTVPATRPVKTTIVESRSVIRKDFSGIVEAVEYVKLAF
RVSGQIISLPVIEGEKVKKGQLIAAIDPRDIALQYAATKSAYETASAQVERNKRLLSRQA
ISVQEYEISLSNYQKAKSEYELSSNNMRDTKLTAPFDGSIEKRLVENYQRVNSGEGIVQL
VNTQNLRIKFTIPDAYLYLLRAKDPRFLVEFDTFKGHVFKARLEEYLDISTEGTGIPVSI
TIDDPSFDRDLYAVKPGFTCSIRFTADVGPLVQDSWTIIPLSAVFGESDGNNMYVWVVED
NKVHKRKIVVNAPTGEAQVLVSEGLKPGEQIVIAGVYQLVEGESIKSIDK