Protein Info for BT_1664 in Bacteroides thetaiotaomicron VPI-5482

Name: ruvC
Annotation: Holliday junction resolvase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 PF02075: RuvC" amino acids 10 to 160 (151 residues), 137 bits, see alignment E=2.5e-44 TIGR00228: crossover junction endodeoxyribonuclease RuvC" amino acids 10 to 161 (152 residues), 130.3 bits, see alignment E=2.9e-42

Best Hits

Swiss-Prot: 94% identical to RUVC_BACFN: Crossover junction endodeoxyribonuclease RuvC (ruvC) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K01159, crossover junction endodeoxyribonuclease RuvC [EC: 3.1.22.4] (inferred from 100% identity to bth:BT_1664)

Predicted SEED Role

"Crossover junction endodeoxyribonuclease RuvC (EC 3.1.22.4)" in subsystem DNA-replication or RuvABC plus a hypothetical (EC 3.1.22.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.22.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A761 at UniProt or InterPro

Protein Sequence (188 amino acids)

>BT_1664 Holliday junction resolvase (RefSeq) (Bacteroides thetaiotaomicron VPI-5482)
MIQPVKEKIILGIDPGTTIMGYGVLRVKGTKPEMIAMGIIDLRKFANHYLKLRHIHERVL
SIIESYLPDELAIEAPFFGKNVQSMLKLGRAQGVAMAVALSRDIPITEYAPLKIKMAITG
NGQASKEQVADMLQRMLHFPKEEMPTFMDATDGLAAAYCHFLQMGRPAMEKGYSSWKDFI
AKNPDKVK