Protein Info for BT1658 in Bacteroides thetaiotaomicron VPI-5482

Annotation: transaldolase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to TAL_BACTN: Probable transaldolase (tal) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 100% identity to bth:BT_1658)

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

superpathway of glucose and xylose degradation (16/17 steps found)
pentose phosphate pathway (8/8 steps found)
pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
Bifidobacterium shunt (12/15 steps found)
Rubisco shunt (8/10 steps found)
formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A767 at UniProt or InterPro

Protein Sequence (218 amino acids)

>BT1658 transaldolase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKFFIDTANLEQIQEAYDLGVLDGVTTNPSLMAKEGIKGTENQREHYIKICKIVNADVSA
EVIATDYEGMIREGEELAALNPHIVVKVPCIADGIKAIKYFTEKGIRTNCTLVFSVGQAL
LAAKAGATYVSPFVGRLDDICEDGVGLVGDIVRMYRTYDYKTQVLAASIRNTKHIIECVE
VGADVATCPLSAIKGLLNHPLTDSGLKKFLEDYKKVNG