Protein Info for BT1601 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative signal recognition protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 TIGR00959: signal recognition particle protein" amino acids 2 to 425 (424 residues), 641.5 bits, see alignment E=3.2e-197 PF02881: SRP54_N" amino acids 5 to 82 (78 residues), 71.1 bits, see alignment E=2.2e-23 PF06414: Zeta_toxin" amino acids 96 to 191 (96 residues), 32.5 bits, see alignment E=1.8e-11 PF00448: SRP54" amino acids 99 to 295 (197 residues), 258.2 bits, see alignment E=1.4e-80 PF02978: SRP_SPB" amino acids 308 to 438 (131 residues), 164.2 bits, see alignment E=5.7e-52

Best Hits

Swiss-Prot: 56% identical to SRP54_BACSU: Signal recognition particle protein (ffh) from Bacillus subtilis (strain 168)

KEGG orthology group: K03106, signal recognition particle subunit SRP54 (inferred from 100% identity to bth:BT_1601)

Predicted SEED Role

"Signal recognition particle, subunit Ffh SRP54 (TC 3.A.5.1.1)" in subsystem Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A7C3 at UniProt or InterPro

Protein Sequence (440 amino acids)

>BT1601 putative signal recognition protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MFDNLSERLERSFKILKGEGKITEINVAETLKDVRKALLDADVNYKVAKTFTDTVKEKAI
GQNVLTAVKPSQLMVKIVHDELTQLMGGETVEINLESRPAVILMSGLQGSGKTTFSGKLA
RMLKTKKNRKPLLVACDVYRPAAIEQLRVLAEQIEVPMYSELDSKNPVEIAQHAIQEAKA
KGYDLVIVDTAGRLAVDEQMMNEITAIKEAINPDEILFVVDSMTGQDAVNTAKEFNERLD
FNGVVLTKLDGDTRGGAALSIRSVVNKPIKFVGTGEKLDAIDQFHPARMADRILGMGDIV
SLVERAQEQYDEEEAKRLQKKIAKNQFDFNDFLSQIAQIKKMGNLKELASMIPGVGKAIK
DIDIDDNAFKSIEAIIYSMTPAERSNPEILNGSRRTRIAKGSGTTIQEVNRLLKQFDQTR
KMMKMVTSSKMGKMMPKMKK