Protein Info for BT1600 in Bacteroides thetaiotaomicron VPI-5482

Annotation: BexA, membrane proein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 47 to 73 (27 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 110 to 126 (17 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details PF01554: MatE" amino acids 58 to 207 (150 residues), 45.4 bits, see alignment E=3.6e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1600)

Predicted SEED Role

"BexA, membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A7C4 at UniProt or InterPro

Protein Sequence (257 amino acids)

>BT1600 BexA, membrane proein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MGIKGAAIASVLAEASSILFFLIYTYISVDLKKYGLNRLRSFDPALLMRILSISCFTMLQ
YFLSMATWFVFFVAVERLGQRELAIANIVRSIYVVLLIPVNALATTTNSLVSNAIGAGGI
QYVMPLINKIARFSFFIMLGLVGLSVLFPQFLLSVYTSEAALITESVPSVYVICCAMLIA
SVANVVFNGISGTGNTQAALLLETITIAIYGSYIVFVGMWLKAPIEICFTIEILYYTLLL
ITSYIYLKKAKWQNKKI