Protein Info for BT1599 in Bacteroides thetaiotaomicron VPI-5482

Annotation: BexA, membrane protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 82 to 105 (24 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 155 to 172 (18 residues), see Phobius details PF01554: MatE" amino acids 13 to 169 (157 residues), 88.3 bits, see alignment E=2.4e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1599)

Predicted SEED Role

"BexA, membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A7C5 at UniProt or InterPro

Protein Sequence (173 amino acids)

>BT1599 BexA, membrane protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MYTNKQIWSVSYPILLSLLAQNVINVTDTAFLGHVSEVALGASAMGGLFYICIFTIAFGF
STGSQIVIARRNGEGRYSDVGPVMIQGIMFLLLIAILMFGFTKAFGGNIMRLLVSSESIY
EGTMEFLDWRIYGFFFSFVNVMFRALYIGITRTKVLTINAVVMALTNVIWTMH