Protein Info for BT1577 in Bacteroides thetaiotaomicron VPI-5482

Annotation: pyridoxamine 5'-phosphate oxidase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 TIGR00558: pyridoxamine 5'-phosphate oxidase" amino acids 3 to 213 (211 residues), 271.3 bits, see alignment E=2.8e-85 PF12766: Pyridox_oxase_2" amino acids 31 to 113 (83 residues), 27.3 bits, see alignment E=7e-10 PF01243: PNPOx_N" amino acids 33 to 153 (121 residues), 97.8 bits, see alignment E=8.5e-32 PF10590: PNP_phzG_C" amino acids 172 to 213 (42 residues), 77.5 bits, see alignment 8.5e-26

Best Hits

Swiss-Prot: 100% identical to PDXH_BACTN: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 100% identity to bth:BT_1577)

MetaCyc: 47% identical to pyridoxine/pyridoxamine 5'-phosphate oxidase (Escherichia coli K-12 substr. MG1655)
Pyridoxal 5'-phosphate synthase. [EC: 1.4.3.5]; 1.4.3.5 [EC: 1.4.3.5]

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.5

Use Curated BLAST to search for 1.4.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A7E7 at UniProt or InterPro

Protein Sequence (213 amino acids)

>BT1577 pyridoxamine 5'-phosphate oxidase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKNIADIRQEYTKSGLRESELPCDPLSLFSRWLQEAIDANVEEPTAIIVGTVSPEGRPST
RTVLLKGLHDGKFIFYTNYESRKGRQLAQNPYISLSFVWHELERQVHIEGTAAKVSPEES
DEYFRKRPYKSRIGARISPQSQPIASRMQLIRAFVKEAARWLGKEVERPDNWGGYAVTPT
RMEFWQGRPNRLHDRFLYTLKTDGKWEINRLSP