Protein Info for BT1560 in Bacteroides thetaiotaomicron VPI-5482

Annotation: nicotinate-nucleotide pyrophosphorylase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)
  • amino acids 12 to 280 (269 residues), 315.6 bits, E=1.2e-98
• PF02749: QRPTase_N
  • amino acids 20 to 109 (90 residues), 90.8 bits, E=4.7e-30
• PF01729: QRPTase_C
  • amino acids 111 to 280 (170 residues), 194.7 bits, E=1e-61

Best Hits

Swiss-Prot: 40% identical to NADC_PSEAE: Nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 100% identity to bth:BT_1560)

MetaCyc: 41% identical to quinolinate phosphoribosyltransferase (decarboxylating) (Nicotiana rustica)
Nicotinate-nucleotide diphosphorylase (carboxylating). [EC: 2.4.2.19]

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

• NAD de novo biosynthesis I (6/6 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• aspartate superpathway (19/25 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD de novo biosynthesis II (from tryptophan) (4/9 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of NAD biosynthesis in eukaryotes (6/14 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Sequence Analysis Tools

See Q8A7G4 at UniProt or InterPro

Protein Sequence (282 amino acids)

>BT1560 nicotinate-nucleotide pyrophosphorylase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNKEKELIDKLIDLAFAEDIGDGDHTTLSCIPATAMGKSKLLIKEAGVLAGIEVAKEIFN
RFDPSMKVEVFINDGTEVKPGDVAMIVEGKVQSLLQTERLMLNVMQRMSGIATMTRKYAR
QLEGTHTRVLDTRKTTPGMRILEKMAVKIGGGVNHRIGLFDMILLKDNHVDFAGGIDKAI
NRAKDYCKEKGKDLKIEIEVRNFDELQQVLDLGGVDRIMFDNFTPEMTKKAVDMVAGKYE
TESSGGITFDTLRDYAECGVDFISVGALTHSVKGLDMSFKAC