Protein Info for BT1554 in Bacteroides thetaiotaomicron VPI-5482

Annotation: alanine dehydrogenase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 TIGR00518: alanine dehydrogenase" amino acids 1 to 364 (364 residues), 522.7 bits, see alignment E=2.4e-161 PF05222: AlaDh_PNT_N" amino acids 4 to 137 (134 residues), 159.9 bits, see alignment E=6.3e-51 PF01262: AlaDh_PNT_C" amino acids 141 to 353 (213 residues), 291.1 bits, see alignment E=6.8e-91 PF02826: 2-Hacid_dh_C" amino acids 167 to 268 (102 residues), 26 bits, see alignment E=8.3e-10

Best Hits

Swiss-Prot: 57% identical to DHA_METMP: Alanine dehydrogenase (ald) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00259, alanine dehydrogenase [EC: 1.4.1.1] (inferred from 100% identity to bth:BT_1554)

MetaCyc: 58% identical to alanine dehydrogenase subunit (Klebsiella aerogenes)
Alanine dehydrogenase. [EC: 1.4.1.1]

Predicted SEED Role

"Alanine dehydrogenase (EC 1.4.1.1)" in subsystem Pyruvate Alanine Serine Interconversions (EC 1.4.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A7H0 at UniProt or InterPro

Protein Sequence (368 amino acids)

>BT1554 alanine dehydrogenase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MIIGVPKEIKNNENRVGMTPSGVAEVVKQGHQVYIQHTAGINSGFPDEAYLSVGAQVLPT
IEDVYATADMIVKVKEPIAPEYHLIRKGQLLFTYFHFASDKELTLAMIDNKSICLAYETV
EKEDHSLPLLIPMSEVAGRMSIQEGARFLEKPQGGKGILLGGVPGVKPAKVLILGGGIVG
SNAAQMAAGMGADVTVADINLSRLRYLSETLPKNVKTLYASELRIKKELPDVDLVIGSVL
IPGDKAPHLITRNILAMMQPGTVLVDVAIDQGGCFETSHPTTHSAPTYVIDGIVHYAVAN
IPGAVPYTSTLALTNATLPYVIALANKGWKKACKDDPALALGLNVVEGKVVYKAVADVFD
LKYENINL