Protein Info for BT1547 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 55 to 79 (25 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 115 to 132 (18 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 282 to 300 (19 residues), see Phobius details amino acids 320 to 341 (22 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details PF04235: DUF418" amino acids 227 to 387 (161 residues), 153.4 bits, see alignment E=2.8e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1547)

Predicted SEED Role

"conserved hypothetical protein, putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A7H7 at UniProt or InterPro

Protein Sequence (391 amino acids)

>BT1547 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MELLKKTPRIEVVDALRGFAVMAILLVHNLEHFIFPVYPESSPEWLSILDAGVFNAVFSL
FAGKSYAIFALLFGFTFYIQSHNQQLKGKDFGYRFLWRLVLLAGFATLNAAFFPAGDVLL
LFVVVGIILFIVRKWSDKAILITAILFSLQPIEWFHYIMSLFNPAYTLPDLNVGAMYSEV
ADYTKNGTFWEFLIGNVTLGQKASLFWAIGAGRFLQTAGLFLFGLYIGRKELFVTSESHL
KFWTKALIIAAISFAPLYSLKEQIMQSDSSLIQQTVGTAFDMWQKFAFTIVLIASFILLY
QKAKFQKTVSNLRFYGKMSLTNYITQSIMGAIIYFPFGFYLAPYCGYTLSLIIGIILFLL
QVQFCKWWLSKHKQGPLETIWHKWTWLGAKK