Protein Info for BT1546 in Bacteroides thetaiotaomicron VPI-5482

Annotation: acyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 22 to 41 (20 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 168 to 191 (24 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 261 to 284 (24 residues), see Phobius details amino acids 296 to 318 (23 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 5 to 315 (311 residues), 95.7 bits, see alignment E=1.5e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1546)

Predicted SEED Role

"Acyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A7H8 at UniProt or InterPro

Protein Sequence (335 amino acids)

>BT1546 acyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MVFGAHCYVLDTSFDAHFFKEGFVGVSFFFVLSGFIIAYNYQEKLLTKTTTKRTFWVARI
ARIYPLHLLTLLIAACIGGYVQYSDTTDWIKHFVASTFLLQPFFPSADYFFSFNSPSWSL
GCEQLFYFCFPFVIPFLSSRRKLLVVLSICLPVMLAGMYLTADEQIKAYWYVNPITRLPD
FFVGVLLYQIYQSLHNKKISSSTGTLLEVASVALFLLFYLCAADIPKVYRYSCYYWLPVS
LMILIFAFQKGGISRLLSNRFLIIGGEISYSFYLIHLFIILTYTKMAALYQWQVSWMISV
PLIFGITIILSLLSYYYFEKPANKWVKRILTKKQS