Protein Info for BT1525 in Bacteroides thetaiotaomicron VPI-5482

Annotation: phosphatidylglycerophosphatase A (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 signal peptide" amino acids 12 to 17 (6 residues), see Phobius details transmembrane" amino acids 22 to 43 (22 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 102 to 119 (18 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details PF04608: PgpA" amino acids 11 to 154 (144 residues), 137 bits, see alignment E=2.2e-44

Best Hits

KEGG orthology group: K01095, phosphatidylglycerophosphatase A [EC: 3.1.3.27] (inferred from 100% identity to bth:BT_1525)

Predicted SEED Role

"Phosphatidylglycerophosphatase A (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A7J9 at UniProt or InterPro

Protein Sequence (159 amino acids)

>BT1525 phosphatidylglycerophosphatase A (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKRPSFLPVLIGTGFGSGFSPFAPGTAGALLASIIWIALYFLLPFTALLWTTAALVVLFT
FAGIWAANKLESCWGEDPSRVVVDEMVGVWIPLLAVPDNDRWYWYVIAAFALFRIFDIVK
PLGVRKMENFKGGVGVMMDDVLAGVYSFILIAVARWVIG