Protein Info for BT1496 in Bacteroides thetaiotaomicron VPI-5482

Annotation: hemolysin-related protein, containing CBS domain (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details TIGR03520: gliding motility-associated protein GldE" amino acids 1 to 340 (340 residues), 510.5 bits, see alignment E=1.9e-157 PF01595: CNNM" amino acids 6 to 107 (102 residues), 54.9 bits, see alignment E=1.4e-18 PF00571: CBS" amino acids 125 to 180 (56 residues), 25.2 bits, see alignment E=2.5e-09 amino acids 195 to 244 (50 residues), 28.3 bits, see alignment 2.8e-10 PF03471: CorC_HlyC" amino acids 261 to 340 (80 residues), 67.2 bits, see alignment E=1.5e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1496)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A7M8 at UniProt or InterPro

Protein Sequence (352 amino acids)

>BT1496 hemolysin-related protein, containing CBS domain (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MLCNFFFMNVFVFHSPLAEFIILTVILTFLLLLFGEIMPKIYSAQKTLAFCRFSAPGIYF
LEKLFHPVASMLVRSTTFLNKHFAKKNHNISVDELSHALELTDKAEISEENNILEGIIRF
GGETVKEVMTSRLDMVDLDVRTPFKEVMQCIIENAYSRIPIYSGSRDNIKGVLYIKDLLP
HVNKGDNFRWQSLIRPAYFVPETKMIDDLLRDFQANKIHIAIVVDEFGGTSGLVTMEDII
EEIVGEIHDEYDDEERTYVVLNDHTWIFEAKTQLTDFYKIAKVDEDEFEKVVGDADTLAG
MLLEIKGEFPALHEKVTYHNYEFEVLEMDSRRILKVKFTILPKEMDESESKE