Protein Info for BT1383 in Bacteroides thetaiotaomicron VPI-5482

Annotation: oxidoreductase, aldo/keto reductase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF00248: Aldo_ket_red" amino acids 21 to 257 (237 residues), 166.3 bits, see alignment E=4.2e-53

Best Hits

Swiss-Prot: 49% identical to GR_BACSU: Glyoxal reductase (yvgN) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to bth:BT_1383)

MetaCyc: 49% identical to glyoxal/methylglyoxal reductase (Bacillus subtilis subtilis 168)
Aryl-alcohol dehydrogenase (NADP(+)). [EC: 1.1.1.91]; 1.1.1.91 [EC: 1.1.1.91]; Methylglyoxal reductase (NADPH-dependent). [EC: 1.1.1.91, 1.1.1.283]

Predicted SEED Role

"oxidoreductase, aldo/keto reductase family"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.283 or 1.1.1.91

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A7Z1 at UniProt or InterPro

Protein Sequence (278 amino acids)

>BT1383 oxidoreductase, aldo/keto reductase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
METVRLNNGVEMPILGYGVYQVTPEECERCVLDAISVGYRSIDTAQAYYNEEGVGNAVRK
CGVPREELFITTKVWISNGGYEKAKASIDESLRKLQSDYVDLLLIHQPFNDYYGTYRAME
EAYKAGKARAIGVSNFYPDRFIDLAEFCEIKPAVNQVETHVFNQQVKPQEIMKKYDTKVM
SWGPFAEGRNNFFSNEVLKAIGEQYGKSVAQVALRFLIQRDIIVIPKSTRKERMIENFDV
FDFTLSVKDMEEIAGLDKKESLFFSHYDPEMVNFLINL