Protein Info for BT1374 in Bacteroides thetaiotaomicron VPI-5482

Updated annotation (from data): diaminopimelate decarboxylase (EC 4.1.1.20)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR01048.
Original annotation: diaminopimelate decarboxylase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01048: diaminopimelate decarboxylase
  • amino acids 12 to 377 (366 residues), 405.5 bits, E=1e-125
• PF00278: Orn_DAP_Arg_deC
  • amino acids 17 to 361 (345 residues), 95.7 bits, E=1.6e-31
• PF02784: Orn_Arg_deC_N
  • amino acids 34 to 272 (239 residues), 173.3 bits, E=6.3e-55

Best Hits

Swiss-Prot: 100% identical to DCDA_BACTN: Diaminopimelate decarboxylase (lysA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 100% identity to bth:BT_1374)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

• L-lysine biosynthesis III (7/7 steps found)
• L-lysine biosynthesis VI (7/7 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• aspartate superpathway (19/25 steps found)
• L-lysine biosynthesis I (6/9 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (12/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

See Q8A800 at UniProt or InterPro

Protein Sequence (386 amino acids)

>BT1374 diaminopimelate decarboxylase (EC 4.1.1.20) (Bacteroides thetaiotaomicron VPI-5482)
MKGIFPIDKFRTLQTPFYYYDTKVLRDTLSAINQEVAKYPSYSVHYAVKANANPKVLTII
RESGMGADCVSGGEIRAAVRAGFPANKIVFAGVGKADWEINLGLEYGIFCFNVESIPELE
VINELAAAQNKIANVAFRINPDVGAHTHANITTGLAENKFGISMQDMDRVIDVALEMKNV
KFIGLHFHIGSQILDMGDFIALCNRVNELQDKLEARRILVEHINVGGGLGIDYGHPNRQS
VPDFKSYFATYAGQLKLRPYQTLHFELGRAVVGQCGSLISKVLYVKQGTKKKFAILDAGM
TDLIRPALYQAYHKMENITSEEPVEAYDVVGPICESSDVFGKAIDLNKVKRGDLIALRSA
GAYGEIMASGYNCRELPKGYTSDELV